PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000132832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 454aa    MW: 49535.1 Da    PI: 6.7461
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000132832genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85e-13212256347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar   ++Rt+ q+ s+ qky
    MDP0000132832 212 PWTEEEHRMFLIGLQKLGKGDWRGIARSYVTTRTPTQVASHAQKY 256
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.481205261IPR017930Myb domain
SMARTSM007179.1E-9209259IPR001005SANT/Myb domain
SuperFamilySSF466895.83E-16211262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-10211255IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-17212260IPR006447Myb domain, plants
PfamPF002491.5E-10212256IPR001005SANT/Myb domain
CDDcd001678.75E-9212257No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RVGSSSSSPS LCGGGGVKLF GVRLTDGSII KKSASMGNLS  60
CAVAHYHSSS PNPDSPSSDP LHDPVHVPDG YLSDDPAHAS SSVNRRGDRK KEFVFVFVFV  120
MLSSLEFGGP STTGAHACTF TILLEFGGPS ILGFWIIHKF CQRLRYSASN NALTTVNILL  180
ESSNSCLPPI IVEIFGLEWN LDEVMFMVLG TPWTEEEHRM FLIGLQKLGK GDWRGIARSY  240
VTTRTPTQVA SHAQKYFIRQ SNATRRKRRS SLFDMVPDMA MDPPPVPEEQ VFLPSSREGE  300
SEDANSLPSL NLSLSSETKP METTHEEKVI ELDQEPAMGS NGFPPMAPPY IPAYTSYPWP  360
YWAPSAGPFR EMVGEPSHQP VLRPIPIVPK EPVNVDALGM SQLSLGETER GLKEPSPLSL  420
KLLGEPSRQS AFHPNAPASE PDVSKGKSSA IQAV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.122940.0fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744750.0DQ074475.1 Malus x domestica MYBR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280790.11e-152uncharacterized protein LOC103443746
TrEMBLD9ZJ711e-166D9ZJ71_MALDO; MYBR domain class transcription factor
STRINGGLYMA13G43120.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-45MYB_related family protein